DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and LOC100536112

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_003201747.2 Gene:LOC100536112 / 100536112 -ID:- Length:154 Species:Danio rerio


Alignment Length:139 Identity:47/139 - (33%)
Similarity:84/139 - (60%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NPFVHRIEIDSHIEVAKIYVLTVLLLPIRVVGCVLSLISAWMFACIGLYGMTLDDLKAKPLTGWR 115
            :||:|.:.:.: ::..:..||.|.|.|:|:...||..:..|..|.:.|.|:. :..:|:|:.|||
Zfish    10 HPFIHEVNLTA-LQRIQGLVLGVFLFPVRITLAVLFFLLMWPIARLRLAGLP-ESRRAEPVRGWR 72

  Fly   116 KQM-QYMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIVAKR 179
            :.: .::.....|.|:....|.:|.:|||.|..||||:|.||||||::|.:::..:|.|.:|::.
Zfish    73 RWLFHHVMVFLSRAVFFCVGFLWVRVKGRQAGLKEAPVLAVAPHSSFLDMLVLSVTGLPIVVSRS 137

  Fly   180 ETADIPLLG 188
            |.|.:|::|
Zfish   138 ENAKLPVIG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 36/103 (35%)
LPLAT_LPCAT1-like 126..338 CDD:153253 27/63 (43%)
EF-hand_8 455..507 CDD:290545
LOC100536112XP_003201747.2 LPLAT 85..>146 CDD:302626 26/60 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1266853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.