DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31855 and dda1

DIOPT Version :9

Sequence 1:NP_001137822.1 Gene:CG31855 / 318983 FlyBaseID:FBgn0051855 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_998292.1 Gene:dda1 / 796589 ZFINID:ZDB-GENE-040426-2137 Length:104 Species:Danio rerio


Alignment Length:109 Identity:46/109 - (42%)
Similarity:63/109 - (57%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVRDFIKGLPIHDSSNFTHLSNEHGIRTSQKRASVYLPTEDEHSEQLIVMDKRCVLLRYLTQQW 65
            |...||:||||:::.:||:....:...:.|.:|.||||||.:..|||:||.:|..:|||||.|||
Zfish     1 MDKADFLKGLPVYNKTNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQW 65

  Fly    66 DKKTLQRKREHGGDSGNGNGNSSTPNGNSTNSKKRPRLDPNELN 109
            |||...:|||.  :...|.|.|..|      .:|..|.|..|:|
Zfish    66 DKKNAAKKREQ--EQAEGEGGSPAP------PRKIARTDSQEMN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31855NP_001137822.1 DDA1 5..67 CDD:287181 30/61 (49%)
dda1NP_998292.1 DDA1 5..67 CDD:401980 30/61 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..104 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577451
Domainoid 1 1.000 72 1.000 Domainoid score I9328
eggNOG 1 0.900 - - E1_KOG4816
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5130
OMA 1 1.010 - - QHG49629
OrthoDB 1 1.010 - - D1521756at2759
OrthoFinder 1 1.000 - - FOG0006559
OrthoInspector 1 1.000 - - oto39454
orthoMCL 1 0.900 - - OOG6_106753
Panther 1 1.100 - - LDO PTHR31879
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5180
SonicParanoid 1 1.000 - - X5556
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.