DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31855 and DDA1

DIOPT Version :9

Sequence 1:NP_001137822.1 Gene:CG31855 / 318983 FlyBaseID:FBgn0051855 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_076955.1 Gene:DDA1 / 79016 HGNCID:28360 Length:102 Species:Homo sapiens


Alignment Length:105 Identity:43/105 - (40%)
Similarity:62/105 - (59%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFIKGLPIHDSSNFTHLSNEHGIRTSQKRASVYLPTEDEHSEQLIVMDKRCVLLRYLTQQWDKKT 69
            ||:||||:::.|||:....:...:.|.:|.||||||.:..|||:||.:|..:|||||.||||||.
Human     3 DFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKN 67

  Fly    70 LQRKREHGGDSGNGNGNSSTPNGNSTNSKKRPRLDPNELN 109
            ..:||:.  :.....|.||.|      .:|..|.|..:::
Human    68 AAKKRDQ--EQVELEGESSAP------PRKVARTDSPDMH 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31855NP_001137822.1 DDA1 5..67 CDD:287181 31/61 (51%)
DDA1NP_076955.1 DDA1 3..65 CDD:401980 31/61 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..102 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144365
Domainoid 1 1.000 73 1.000 Domainoid score I9299
eggNOG 1 0.900 - - E1_KOG4816
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5222
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49629
OrthoDB 1 1.010 - - D1521756at2759
OrthoFinder 1 1.000 - - FOG0006559
OrthoInspector 1 1.000 - - oto91245
orthoMCL 1 0.900 - - OOG6_106753
Panther 1 1.100 - - LDO PTHR31879
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5180
SonicParanoid 1 1.000 - - X5556
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.