DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31855 and dda1

DIOPT Version :9

Sequence 1:NP_001137822.1 Gene:CG31855 / 318983 FlyBaseID:FBgn0051855 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001017216.1 Gene:dda1 / 549970 XenbaseID:XB-GENE-973045 Length:101 Species:Xenopus tropicalis


Alignment Length:105 Identity:42/105 - (40%)
Similarity:61/105 - (58%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFIKGLPIHDSSNFTHLSNEHGIRTSQKRASVYLPTEDEHSEQLIVMDKRCVLLRYLTQQWDKKT 69
            ||:||||:::.|||:....:...:.|.:|.||||||.:..|:|:||.:|..:|||||.||||||.
 Frog     3 DFLKGLPVYNESNFSRFHADSVCKASNRRPSVYLPTREYPSDQIIVTEKTNILLRYLHQQWDKKN 67

  Fly    70 LQRKREHGGDSGNGNGNSSTPNGNSTNSKKRPRLDPNELN 109
            ..:||:   ......|.:|.|      .:|..|.|..|::
 Frog    68 AAKKRD---QDQLEIGETSAP------PRKIARTDSQEMS 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31855NP_001137822.1 DDA1 5..67 CDD:287181 30/61 (49%)
dda1NP_001017216.1 DDA1 3..65 CDD:370853 30/61 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..101 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9174
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5075
OMA 1 1.010 - - QHG49629
OrthoDB 1 1.010 - - D1521756at2759
OrthoFinder 1 1.000 - - FOG0006559
OrthoInspector 1 1.000 - - otm49239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5180
SonicParanoid 1 1.000 - - X5556
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.