DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31855 and F48C1.5

DIOPT Version :9

Sequence 1:NP_001137822.1 Gene:CG31855 / 318983 FlyBaseID:FBgn0051855 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001379598.1 Gene:F48C1.5 / 185975 WormBaseID:WBGene00018598 Length:124 Species:Caenorhabditis elegans


Alignment Length:111 Identity:24/111 - (21%)
Similarity:48/111 - (43%) Gaps:18/111 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPIHDSSNFTHLS-NEHGIRTSQKRASVYLPTEDEHSEQL--IVMDKRCVLLRYLTQQW---DKK 68
            ||..:..:||.|| .:..:|.::....|....|.|::.:.  |...|...::.:|.:.:   .|:
 Worm     9 LPCKNPESFTKLSAKKDTVRKTEPVEVVCRNVEGENNGECYKIKAPKTPFIINHLEKNYIPKPKE 73

  Fly    69 TLQR---------KREHG---GDSGNGNGNSSTPNGNSTNSKKRPR 102
            |.::         ||||.   .|....:.|..:.:...::|:|:.|
 Worm    74 TTKKRRAGEAGGVKREHSTSESDDQLEDANQPSTSSQQSSSRKKQR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31855NP_001137822.1 DDA1 5..67 CDD:287181 13/62 (21%)
F48C1.5NP_001379598.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.