DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and Nat8f2

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_444326.2 Gene:Nat8f2 / 93673 MGIID:2136446 Length:238 Species:Mus musculus


Alignment Length:150 Identity:35/150 - (23%)
Similarity:54/150 - (36%) Gaps:51/150 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAEVYSLPFLLPKIL-------EHPELVLAADAPDNSLMGFILGTRVEDATESFGDAKTMTWNH- 79
            ||.:||..|||...|       .:....|.||              :.|.|:|:.:|....|.. 
Mouse    62 LATLYSFLFLLCLWLIFWISCRNYVAKSLQAD--------------LADITKSYLNAHGSFWVAE 112

  Fly    80 ------GHISA-----------------LAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVR 121
                  |.:.|                 |:|:..:|..|:...|:.||......|.  |.|: |.
Mouse   113 SGDQVVGMVGAQPVKDPPLGKKQMQLFRLSVSSQHRGQGIAKALVRTVLQFARDQG--YSDV-VL 174

  Fly   122 EKNTI---AIGLYESLGYVK 138
            |..::   |..||:::|:.|
Mouse   175 ETGSVQHSAQALYQAMGFQK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 32/145 (22%)
Acetyltransf_1 50..137 CDD:278980 23/113 (20%)
Nat8f2NP_444326.2 RimI <88..197 CDD:223532 26/123 (21%)
Acetyltransf_1 112..193 CDD:278980 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.