DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and ARD1

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_011877.1 Gene:ARD1 / 856404 SGDID:S000001055 Length:238 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:49/233 - (21%)
Similarity:85/233 - (36%) Gaps:75/233 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPE-----------------------LVLAA 46
            |...:.|:....|..:..|.|.|.:.:.:..||..||                       |.|..
Yeast     6 RRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQDENDKLELTL 70

  Fly    47 D---------------APDNSLMGFILGTRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGL 96
            |               ||...|:|::| .::.|..:...:..     :|||::|:|.:.||::|:
Yeast    71 DGTNDGRTIKLDPTYLAPGEKLVGYVL-VKMNDDPDQQNEPP-----NGHITSLSVMRTYRRMGI 129

  Fly    97 GTRL----LTTVRDMMDRQKDFYIDLFVREKNTIAIGLY-ESLGYVKYRWIPKFYAD-DHGYEMR 155
            ...|    |..:|::...:   |:.|.||:.|..|:.|| ::|.:........:|.| :..|.|:
Yeast   130 AENLMRQALFALREVHQAE---YVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMK 191

  Fly   156 L----------------------PLSSDVDRKSLEGII 171
            .                      .|..|::...||.||
Yeast   192 KVLKLEELQISNFTHRRLKENEEKLEDDLESDLLEDII 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 38/196 (19%)
Acetyltransf_1 50..137 CDD:278980 24/91 (26%)
ARD1NP_011877.1 RimI 1..192 CDD:223532 43/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.