DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and NAT3

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_015456.2 Gene:NAT3 / 856249 SGDID:S000006335 Length:195 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:57/188 - (30%)
Similarity:94/188 - (50%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAP------DNSLMGFILG 59
            ||:.:.|...||||.||:.:|.|.|.:.|.|....::..|:|...:...      .:::.|:::.
Yeast     1 MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNISGYMMA 65

  Fly    60 TRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRL---LTTVRDMMDRQKDFYIDLFVR 121
            ..         :.||..| |.||:|:.||..:|::.|.::|   |.|:.|:|..:.:| |||||:
Yeast    66 KT---------EGKTTEW-HTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNF-IDLFVK 119

  Fly   122 EKNTIAIGLYESLGYVKYRWIPKFY-------------ADDH--GYEMRLPLSSDVDR 164
            ..|.:||.|||.|||..||.:..:|             .||:  .::||..::.|.:|
Yeast   120 CNNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 43/154 (28%)
Acetyltransf_1 50..137 CDD:278980 31/89 (35%)
NAT3NP_015456.2 RimI 1..160 CDD:223532 51/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S635
OMA 1 1.010 - - QHG53973
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.760

Return to query results.
Submit another query.