DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and MAK3

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_015376.1 Gene:MAK3 / 856163 SGDID:S000006255 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:38/155 - (24%)
Similarity:69/155 - (44%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELV-LAAD---APDNSLMGFILGTRVEDATESFG 70
            |.......::...|:|.||:......:.:.|||. :|.|   ...|..:|.|:...         
Yeast    14 EQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNIPIGCIVCKM--------- 69

  Fly    71 DAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGLYESLG 135
            |........|:|..|||...||..|:..:|:....|.|.|:....|.|....:|:.|:.|||.:|
Yeast    70 DPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETEVENSAALNLYEGMG 134

  Fly   136 YVKYRWIPKFYADD-HGYEMRLPLS 159
            :::.:.:.::|.:: ..:::.|||:
Yeast   135 FIRMKRMFRYYLNEGDAFKLILPLT 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 33/135 (24%)
Acetyltransf_1 50..137 CDD:278980 24/86 (28%)
MAK3NP_015376.1 RimI 26..162 CDD:223532 37/143 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.