DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and NAA10

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_003482.1 Gene:NAA10 / 8260 HGNCID:18704 Length:235 Species:Homo sapiens


Alignment Length:186 Identity:55/186 - (29%)
Similarity:87/186 - (46%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDATESFGDAKT 74
            |||....:..:..|.|.|.:.:.....|..|:|...|:..:..::|::|....||..:.      
Human     9 EDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDV------ 67

  Fly    75 MTWNHGHISALAVAQDYRKLGLGTRLLTTV-RDMMDRQKDFYIDLFVREKNTIAIGLY-ESLGYV 137
               .||||::|||.:.:|:|||..:|:... |.|::.....|:.|.||:.|..|:.|| .:|.:.
Human    68 ---PHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQ 129

  Fly   138 KYRWIPKFYAD-DHGYEMRLPLSSDVD--RKSLE----------GIIIKKIYSFGN 180
            .....||:||| :..|.|:..|:...|  |:.||          |.|..|:.|.||
Human   130 ISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 39/133 (29%)
Acetyltransf_1 50..137 CDD:278980 27/88 (31%)
NAA10NP_003482.1 RimI 1..149 CDD:223532 44/148 (30%)
Interaction with NAA15. /evidence=ECO:0000269|PubMed:15496142 1..58 11/48 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..235 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.