DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and NAA50

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_079422.1 Gene:NAA50 / 80218 HGNCID:29533 Length:169 Species:Homo sapiens


Alignment Length:91 Identity:25/91 - (27%)
Similarity:42/91 - (46%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDF-YIDLFVREKNTIAIGLYESLGYVKYRWIPK 144
            :|..|.....||:||:||::|..|.::.::...| .|.|.|:..|..||..|...|:........
Human    73 YIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKN 137

  Fly   145 FY-----ADDHGYE--MRLPLSSDVD 163
            :|     ||.|..:  :::|...:.|
Human   138 YYKRIEPADAHVLQKNLKVPSGQNAD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 23/84 (27%)
Acetyltransf_1 50..137 CDD:278980 19/56 (34%)
NAA50NP_079422.1 RimI 10..145 CDD:223532 20/71 (28%)
Acetyl-CoA binding. /evidence=ECO:0000269|PubMed:21900231, ECO:0000269|PubMed:27484799, ECO:0000269|Ref.18, ECO:0007744|PDB:2PSW, ECO:0007744|PDB:3TFY, ECO:0007744|PDB:4X5K 77..90 5/12 (42%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:21900231, ECO:0000269|PubMed:27484799, ECO:0000269|Ref.18, ECO:0007744|PDB:2PSW, ECO:0007744|PDB:3TFY, ECO:0007744|PDB:4X5K 117..126 4/8 (50%)
Substrate binding. /evidence=ECO:0000269|PubMed:21900231, ECO:0000269|PubMed:27484799, ECO:0007744|PDB:3TFY, ECO:0007744|PDB:4X5K 138..141 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.