DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and Naa20

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_080701.1 Gene:Naa20 / 67877 MGIID:1915127 Length:188 Species:Mus musculus


Alignment Length:183 Identity:67/183 - (36%)
Similarity:108/183 - (59%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGF--------- 56
            ||:.|.|..:|||:||||.:|||.|.|.:||.|..:...||..:.|:||...|||:         
Mouse     1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYSKYSTTSTF 65

  Fly    57 -ILGTRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFV 120
             ::|       ::.|......| |||::||:||.::|:|||..:|:..:.::.:|:..|::||||
Mouse    66 LVMG-------KAEGSVAREEW-HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFV 122

  Fly   121 REKNTIAIGLYESLGYVKYRWIPKFYA------DDHGYEMRLPLSSDVDRKSL 167
            |..|.:|:.:|:.|||..||.:.::|:      |:..|:||..||.|.::||:
Mouse   123 RVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 47/146 (32%)
Acetyltransf_1 50..137 CDD:278980 30/96 (31%)
Naa20NP_080701.1 RimI 1..166 CDD:223532 62/172 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S635
OMA 1 1.010 - - QHG53973
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.