DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and Nat8f1

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_038964231.1 Gene:Nat8f1 / 59300 RGDID:621606 Length:255 Species:Rattus norvegicus


Alignment Length:218 Identity:48/218 - (22%)
Similarity:83/218 - (38%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FNNIVMDPLAEVYSLPFLLPKILEHPELVLA--------------ADAPDNSLMGFILGTRVEDA 65
            |.:::|.|...:..|...|..:|.....:||              |..|....:...|.|.:.|.
  Rat    43 FRHMLMLPRTLLLLLGVPLALVLVSGSWLLAVVCIFFLLLLLRFLAGQPWKEYVATCLRTDMADI 107

  Fly    66 TESFGDAKTMTW-----NH--GHISA-----------------LAVAQDYRKLGLGTRLLTTVRD 106
            |:|:.:|....|     |.  |.::|                 |:|:..:|..|:...|:.||..
  Rat   108 TKSYLNAHGSFWVAESGNQVVGIVAALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQ 172

  Fly   107 MMDRQKDFYIDLFVREKNTI---AIGLYESLGYVK--YRWIPKFYADDHGYEMRLPLSSD----- 161
            ....|.  |.|: |.|.:|:   |:.||..:|:.|  .|::..|:.  |.|....|.:..     
  Rat   173 FARDQG--YTDV-VLETSTLQQGAMTLYLGMGFQKTGQRFLTMFWR--HHYSRAQPTNKPGAPQD 232

  Fly   162 -VDRKSLEGIIIKKIYSFGNKLY 183
             :..:..||.:.|:..|.|.:::
  Rat   233 WILMQVSEGCLGKRSASQGLEVF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 39/173 (23%)
Acetyltransf_1 50..137 CDD:278980 27/113 (24%)
Nat8f1XP_038964231.1 Acetyltransf_1 92..202 CDD:395465 26/112 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.