DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and NAA20

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_057184.1 Gene:NAA20 / 51126 HGNCID:15908 Length:178 Species:Homo sapiens


Alignment Length:173 Identity:68/173 - (39%)
Similarity:108/173 - (62%) Gaps:14/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDA 65
            ||:.|.|..:|||:||||.:|||.|.|.:||.|..:...||..:.|:||...|||:|:|      
Human     1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMG------ 59

  Fly    66 TESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGL 130
             ::.|......| |||::||:||.::|:|||..:|:..:.::.:|:..|::|||||..|.:|:.:
Human    60 -KAEGSVAREEW-HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNM 122

  Fly   131 YESLGYVKYRWIPKFYA------DDHGYEMRLPLSSDVDRKSL 167
            |:.|||..||.:.::|:      |:..|:||..||.|.::||:
Human   123 YKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 48/136 (35%)
Acetyltransf_1 50..137 CDD:278980 31/86 (36%)
NAA20NP_057184.1 RimI 1..156 CDD:223532 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D1355894at2759
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.