DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and naa20

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_989110.1 Gene:naa20 / 394715 XenbaseID:XB-GENE-969863 Length:178 Species:Xenopus tropicalis


Alignment Length:173 Identity:69/173 - (39%)
Similarity:108/173 - (62%) Gaps:14/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDA 65
            |||.|.|..:|||:||||.:|||.|.|.:||.|..:...||..:.|:||...|||:|:|      
 Frog     1 MTSLRPFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMG------ 59

  Fly    66 TESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGL 130
             ::.|......| |||::||:||.::|:|||..:|:..:.::.:|:..|::|||||..|.:|:.:
 Frog    60 -KAEGSVAREEW-HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNM 122

  Fly   131 YESLGYVKYRWIPKFYA------DDHGYEMRLPLSSDVDRKSL 167
            |:.|||..||.:.::|:      |:..|:||..||.|.::||:
 Frog   123 YKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 48/136 (35%)
Acetyltransf_1 50..137 CDD:278980 31/86 (36%)
naa20NP_989110.1 RimI 1..156 CDD:223532 64/162 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..178 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D1355894at2759
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.