DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and vnc

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_648378.1 Gene:vnc / 39175 FlyBaseID:FBgn0263251 Length:196 Species:Drosophila melanogaster


Alignment Length:161 Identity:50/161 - (31%)
Similarity:78/161 - (48%) Gaps:18/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILG--TRVEDATESFGDA 72
            |||....:..:..|.|.|.:.:.....|..|:|...|.....:::|::|.  ...|...||    
  Fly     9 EDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEES---- 69

  Fly    73 KTMTWNHGHISALAVAQDYRKLGLGTRLLTTV-RDMMDRQKDFYIDLFVREKNTIAIGLYESLGY 136
                 .||||::|||.:.||:|||..:|:... :.|::.....|:.|.||:.|..|:.||.:.  
  Fly    70 -----RHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNA-- 127

  Fly   137 VKYRWI---PKFYAD-DHGYEMRLPLSSDVD 163
            :|::.|   ||:||| :..|.||..||...|
  Fly   128 LKFKIIEVEPKYYADGEDAYAMRRDLSEFAD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 42/137 (31%)
Acetyltransf_1 50..137 CDD:278980 27/89 (30%)
vncNP_648378.1 RimI 1..151 CDD:223532 46/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466536
Domainoid 1 1.000 41 1.000 Domainoid score I768
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.