DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and Naa60

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:63/136 - (46%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAEVYSLP---FLLPKILEHPEL---VLAADAPDNSLMGFILGTRVED---ATESFGDAKTMTWN 78
            ||.||:|.   .::.:|..:..:   |:|..:..:.|...:.|..::|   ..:|.|.:..:   
  Fly    76 LAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADV--- 137

  Fly    79 HGHISALAVAQDYRKLGLGTRLLTTVRDMM---DRQKDFYIDLFVREKNTIAIGLYESLGYVKYR 140
             |:|.:|.|.:.:|:.|:|:.||..:.:.:   :|.....|.|.....|..||..||...:..:.
  Fly   138 -GYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHS 201

  Fly   141 WIPKFY 146
            ::|.:|
  Fly   202 FLPYYY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 29/132 (22%)
Acetyltransf_1 50..137 CDD:278980 22/92 (24%)
Naa60NP_996032.1 RimI 74..207 CDD:223532 31/134 (23%)
Acetyltransf_1 <136..198 CDD:278980 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.