DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and F30F8.10

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001382268.1 Gene:F30F8.10 / 3565178 WormBaseID:WBGene00009277 Length:245 Species:Caenorhabditis elegans


Alignment Length:159 Identity:32/159 - (20%)
Similarity:66/159 - (41%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDATE---- 67
            |.|..|..::.:.::.|.. .|.|      :::|:...     |..:.|.:|.|.:.|..:    
 Worm    46 FTLRRLQTWDRMAVEALCN-ESFP------IQYPDCWY-----DEVVSGGLLSTGLFDGEQLAAM 98

  Fly    68 -----------SFGDAKTMTWNHGHIS---ALAVAQDYRKLGLGTRLLTTVRDMMDRQKDF--YI 116
                       :..|...:..::.|::   ::||.:.:|:|||.||||..:...:.....:  .:
 Worm    99 VVSETKFLYDCNLEDQGILPSSNAHVAYILSIAVDKKFRRLGLATRLLNNLMSSLSDHPPYPRAV 163

  Fly   117 DLFVREKNTIAIGLYESLGYVKYRWIPKF 145
            .|.|...|:.|:..|:..|:..:..:|.|
 Worm   164 FLHVLSTNSAALSFYKMHGFEFHASLPYF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 28/139 (20%)
Acetyltransf_1 50..137 CDD:278980 23/106 (22%)
F30F8.10NP_001382268.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.