DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and Atac2

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster


Alignment Length:91 Identity:24/91 - (26%)
Similarity:41/91 - (45%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WNHGHISALAVAQDYRKLGLGTRLL-TTVRDMMDRQKDFYIDLFVREKNTIAIGLYESLGYVKYR 140
            :|..:||.:||...:::.|:.:.:| ..::..|.:.    |.|.|...|. |:.||:..|:....
  Fly   688 YNEAYISFMAVRPCWQRSGIASFMLYHLIQTCMSKD----ITLHVSATNA-AVMLYQKFGFKMEE 747

  Fly   141 WIPKFYADDHGYEMRLPLSSDVDRKS 166
            .|..|      |:..|||.|...|.:
  Fly   748 IILDF------YDKYLPLDSKQSRNA 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 20/81 (25%)
Acetyltransf_1 50..137 CDD:278980 16/60 (27%)
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 18/75 (24%)
Acetyltransf_1 676..744 CDD:278980 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.