DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and NAT8L

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_848652.2 Gene:NAT8L / 339983 HGNCID:26742 Length:302 Species:Homo sapiens


Alignment Length:95 Identity:24/95 - (25%)
Similarity:35/95 - (36%) Gaps:27/95 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VLAADAPDNSLMGFILGTRVEDATESFGDAKTMTWNHGH-ISALAVAQDYRKLGLGTRLLTTVRD 106
            ::||.|.:......:|...|:......|.||.:    |. :...||..:|..:.|||   |.|: 
Human   196 IVAARAHEEDNTVELLRMSVDSRFRGKGIAKAL----GRKVLEFAVVHNYSAVVLGT---TAVK- 252

  Fly   107 MMDRQKDFYIDLFVREKNTIAIGLYESLGY 136
                              ..|..||||||:
Human   253 ------------------VAAHKLYESLGF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 24/95 (25%)
Acetyltransf_1 50..137 CDD:278980 21/88 (24%)
NAT8LNP_848652.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..72
Acetyltransf_1 157..264 CDD:366181 23/93 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.