DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and CG31730

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster


Alignment Length:165 Identity:61/165 - (36%)
Similarity:84/165 - (50%) Gaps:23/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPEL--VLAADAPDNSLMGFILG---- 59
            |||.|....:||||.|::|.|.|.|||||.|.:...||.|.|  :..|..||...||:|.|    
  Fly     1 MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQV 65

  Fly    60 TRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKN 124
            .|.:|.             :||::||.|:.:||:|||.|.|:.....:.|.:...|::||:|..|
  Fly    66 KRNQDP-------------YGHVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISN 117

  Fly   125 TIAIGLYESLGYVKYRWIPKFYAD----DHGYEMR 155
            ..|..||.||||...:....:|.|    :..||:|
  Fly   118 RAAYQLYTSLGYAHRQTFLDYYPDEPKPESAYELR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 47/139 (34%)
Acetyltransf_1 50..137 CDD:278980 31/90 (34%)
CG31730NP_723799.1 rimI 9..141 CDD:273701 53/144 (37%)
Acetyltransf_1 52..129 CDD:278980 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452067
Domainoid 1 1.000 41 1.000 Domainoid score I768
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D121425at6656
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.