DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and naa20

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_587922.1 Gene:naa20 / 2539279 PomBaseID:SPCC16C4.12 Length:180 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:67/174 - (38%)
Similarity:102/174 - (58%) Gaps:17/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPEL--VLAADAPDNSLMGFILGTRVE 63
            ||..|.|...|||.||||.:|||.|.:::.|.|..:.:.|.|  |..:|..|.:|||:|:|    
pombe     1 MTDTRKFKATDLFSFNNINLDPLTETFNISFYLSYLNKWPSLCVVQESDLSDPTLMGYIMG---- 61

  Fly    64 DATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAI 128
               :|.|..|  .| |.|::|:.||.:.|:|||...::..:..:.:.:..|::|||||..|.:||
pombe    62 ---KSEGTGK--EW-HTHVTAITVAPNSRRLGLARTMMDYLETVGNSENAFFVDLFVRASNALAI 120

  Fly   129 GLYESLGYVKYRWIPKFYADDHG-----YEMRLPLSSDVDRKSL 167
            ..|:.|||..||.:..:|::.||     ::||.|||.||:|:|:
pombe   121 DFYKGLGYSVYRRVIGYYSNPHGKDEDSFDMRKPLSRDVNRESI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 45/137 (33%)
Acetyltransf_1 50..137 CDD:278980 31/86 (36%)
naa20NP_587922.1 RimI 1..155 CDD:223532 60/163 (37%)
Acetyltransf_1 52..128 CDD:278980 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53973
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.