DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and F40F4.7

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001379902.1 Gene:F40F4.7 / 180614 WormBaseID:WBGene00018238 Length:245 Species:Caenorhabditis elegans


Alignment Length:89 Identity:23/89 - (25%)
Similarity:41/89 - (46%) Gaps:14/89 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLL---TTVRDMMDRQKDFYIDLFVRE 122
            |::|    ..|.|::     ::..|.....||::|:||.|:   ..:.:.|:..|..|:.:.|..
 Worm   152 RIDD----ISDEKSL-----YLMTLGTLAAYRQIGIGTILIDYALKLCNKMEEIKTMYLHVQVNN 207

  Fly   123 KNTIAIGLYESLGYVKYRWIPKFY 146
            ||  |:..||..|:.....|..:|
 Worm   208 KN--AVQFYEKHGFTNDGIIEDYY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 23/89 (26%)
Acetyltransf_1 50..137 CDD:278980 21/78 (27%)
F40F4.7NP_001379902.1 RimI <122..245 CDD:223532 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.