DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and Nat8b

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_598242.1 Gene:Nat8b / 171084 RGDID:621605 Length:222 Species:Rattus norvegicus


Alignment Length:144 Identity:38/144 - (26%)
Similarity:55/144 - (38%) Gaps:37/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDATESF-GDAKTMTWNH------- 79
            |..|..:.|||      |.|...|..|..:.:...|.|.:.|.|:|: .|..:..|..       
  Rat    61 LLAVVCIFFLL------PFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVV 119

  Fly    80 GHISA-----------------LAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIA 127
            |.:.|                 |||:..:|..|:...|:.||......|.  |.|: |.|.:|:.
  Rat   120 GTVGALPVKEPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQG--YTDV-VLETSTMQ 181

  Fly   128 IG---LYESLGYVK 138
            ||   ||..:|:.|
  Rat   182 IGAVTLYLGMGFQK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 36/140 (26%)
Acetyltransf_1 50..137 CDD:278980 28/114 (25%)
Nat8bNP_598242.1 hydrophobic domain 36..80 8/24 (33%)
Acetyltransf_1 91..193 CDD:395465 26/104 (25%)
consensus motif D 109..126 3/16 (19%)
consensus motif A 131..166 8/34 (24%)
consensus motif B 174..194 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.