DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20B and nat8.7

DIOPT Version :9

Sequence 1:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_012811282.2 Gene:nat8.7 / 100145252 XenbaseID:XB-GENE-5780700 Length:286 Species:Xenopus tropicalis


Alignment Length:85 Identity:22/85 - (25%)
Similarity:35/85 - (41%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GFILGTRVEDATESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDF-YIDL 118
            |.::|......|:...||..       :..|:||.:.|..|:|..|.....|.. ||:.: .::|
 Frog   184 GRVIGMVGIQPTQDSKDAMV-------LRRLSVASEQRVRGIGKALCMKAIDFA-RQRGYRRVNL 240

  Fly   119 FVREKNTIAIGLYESLGYVK 138
            ........|..|||.:|:.|
 Frog   241 DTSMIQRAAHRLYEGMGFEK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 22/85 (26%)
Acetyltransf_1 50..137 CDD:278980 21/82 (26%)
nat8.7XP_012811282.2 Acetyltransf_1 143..258 CDD:395465 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.