DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31849 and AT1G67880

DIOPT Version :9

Sequence 1:NP_723787.1 Gene:CG31849 / 318981 FlyBaseID:FBgn0051849 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_176955.1 Gene:AT1G67880 / 843116 AraportID:AT1G67880 Length:390 Species:Arabidopsis thaliana


Alignment Length:233 Identity:48/233 - (20%)
Similarity:87/233 - (37%) Gaps:42/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LELLELQIRALIEVVDYFLIYYVSNGSKERSLESML---GSQTSYTLLR------------CSSE 272
            :|||.::.:.|...|..|::  :.:.|....|...|   |.:..:..:.            ...|
plant   124 VELLTIRWKELYPYVTQFVL--LESNSTFTGLPKPLVFAGHRDEFKFIEPRLTYGSIGGRFKKGE 186

  Fly   273 SNCTSSMAYSHFR-RQLWQQCGVQMQAQDLLLHGDSGTVYAPAALKFLKYYAKDVLP--LKFRLK 334
            .|.....||.... .||.:..|:  ...|||:..|...:.:...:..|::.  |.:|  |..|||
plant   187 KNPFYEEAYQRIALDQLLRIAGI--TDDDLLIMSDVDEIPSRHTINLLRWC--DDIPQILHLRLK 247

  Fly   335 YNVYGFYWQHPKKTLLNGVISSLGHLHSAQLDAHRLHRLASSTLGDLNHYGGWNCELCLPP-EQI 398
            ..:|.|.:....|:....|     |.:......:..:|.:...|.|    .||:|..|... .:.
plant   248 NYLYSFEFPVDDKSWRASV-----HRYQTGKTRYAHYRQSDVILAD----SGWHCSFCFRRISEF 303

  Fly   399 VLLLQSSSPRKLPVKLPNDTRNAH-IDANYMQQLIANG 435
            |..:::.|..       :..|.|| ::...:|::|.:|
plant   304 VFKMKAYSHY-------DRVRFAHYLNPKRVQRVICSG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31849NP_723787.1 None
AT1G67880NP_176955.1 Glyco_transf_17 40..388 CDD:282567 48/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D886866at2759
OrthoFinder 1 1.000 - - FOG0002697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104004
Panther 1 1.100 - - O PTHR12224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.