DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31849 and AT1G12990

DIOPT Version :9

Sequence 1:NP_723787.1 Gene:CG31849 / 318981 FlyBaseID:FBgn0051849 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_172759.2 Gene:AT1G12990 / 837857 AraportID:AT1G12990 Length:392 Species:Arabidopsis thaliana


Alignment Length:423 Identity:74/423 - (17%)
Similarity:141/423 - (33%) Gaps:134/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LVGGTHCPHLQENVNRYDKDFYQMKPERLNESHLPDYNVPAYVDAEMGLTPNLWCYREGTINESQ 146
            |.|..|    .:.::.:.:..::..|:       |.:::|.|             |.|....|: 
plant    62 LAGYVH----GQKISYFLRPLWESPPK-------PFHDIPHY-------------YHENASMET- 101

  Fly   147 RLNDVDYLMAPPQCRCESGWHGRDCGQPEIIWRALMTSNRASKRGGSTPLQLVEASSSSLHRLFY 211
                        .|:.. ||..||  .|..::.|::.||                          
plant   102 ------------LCKLH-GWGVRD--YPRRVYDAVLFSN-------------------------- 125

  Fly   212 MLELGAWDHLSLELLELQIRALIEVVDYFL--------------IYYVSNGSKERSLESMLGSQT 262
                      .|::|.::.|.|...:..|:              :.:.::..:.:.:||.|    
plant   126 ----------ELDILAVRWRELFPYITQFVLLESNTTFTGLPKPLVFAAHRDEFKFIESRL---- 176

  Fly   263 SYTLL--RCSSESNCTSSMAYSHFR-RQLWQQCGVQMQAQDLLLHGDSGTVYAPAALKFLKYYAK 324
            :|..:  |.....|.....||.... .||.:..|:  ...||||..|...:.:...:..|::.  
plant   177 TYGTVGGRFVKGQNPFYEEAYQRVALDQLLRIAGI--TDDDLLLMSDVDEIPSRHTINLLRWC-- 237

  Fly   325 DVLP--LKFRLKYNVYGFYWQHPKKTLLNGVISSLGHLHSAQLDAHRLHRLASSTLGDLNHYGGW 387
            |.:|  |..|||..:|.|.:....|:....:     |.:......:..:|.:...|.|    .||
plant   238 DEIPKILHLRLKNYLYSFEFLVDNKSWRASI-----HRYETGKTRYAHYRQSDEILAD----AGW 293

  Fly   388 NCELCLPP-EQIVLLLQSSSPRKLPVKLPND-TRNAH-IDANYMQQLIANGVHI-DGTTQLHRLR 448
            :|..|... .:.:..:::.|        .|| .|..| ::...:|::|..|..: |...:.:..:
plant   294 HCSFCFRRISEFIFKMKAYS--------HNDRVRFGHFLNPKRVQRVICKGADLFDMLPEEYTFK 350

  Fly   449 EQSEK----------YFAPEEALQHSSQYGQLL 471
            |...|          ...|...|:::.:|..||
plant   351 EIIGKMGPIPHSFSAVHLPSYLLENADKYRFLL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31849NP_723787.1 None
AT1G12990NP_172759.2 Glyco_transf_17 43..390 CDD:398414 74/423 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D886866at2759
OrthoFinder 1 1.000 - - FOG0002697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104004
Panther 1 1.100 - - O PTHR12224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.