DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31849 and AT5G14480

DIOPT Version :9

Sequence 1:NP_723787.1 Gene:CG31849 / 318981 FlyBaseID:FBgn0051849 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_196952.1 Gene:AT5G14480 / 831299 AraportID:AT5G14480 Length:387 Species:Arabidopsis thaliana


Alignment Length:346 Identity:61/346 - (17%)
Similarity:113/346 - (32%) Gaps:107/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GWHGRDCGQPEIIWRALMTSNRASKRGGSTPLQLVEASSSSLHRLFYMLELGAWDHLSLELLELQ 229
            ||..|:  .|..::.|::.||                                    .:::|.::
plant   102 GWKHRE--SPRRVFDAVLFSN------------------------------------EVDMLTIR 128

  Fly   230 IRALIEVVDYFLIY------------YVSNGSKERSLESMLGSQTSYTLL--RCSSESNCTSSMA 280
            .:.|...:..|:|.            .|.||:  |:.......:.||..:  |.....|.....|
plant   129 WKELYPYITQFVILESNSTFTGLPKPLVFNGN--RAKFEFAEPRLSYGNIAGRFKKGENPFVEEA 191

  Fly   281 YSHFR-RQLWQQCGVQMQAQDLLLHGDSGTVYAPAALKFLKYYAKDVLP--LKFRLKYNVYGFYW 342
            |.... .||.:..|:  :..|||:..|...:.:...:..|::.  |..|  |..:||..:|.|.:
plant   192 YQRIALDQLIRLAGI--EEDDLLIMSDVDEIPSAHTINLLRWC--DGYPPILHLQLKNYLYSFEY 252

  Fly   343 QHPKKTLLNGVISSLGHLHSAQLDAHRLHRLASSTLGDLNHYGGWNCELCLPP-EQIVLLLQSSS 406
            ....|:....:     |.:......:...|..::.|.|    .||:|..|... .:.:..:::.|
plant   253 FVDNKSWRASI-----HQYKPGKTRYAHFRQGNTLLAD----SGWHCSFCFRHISEFIFKMKAYS 308

  Fly   407 PRKLPVKLPND-TRNAH-IDANYMQQLIANGVHI-DGTTQLHRLRE------------------- 449
                    .|| .|.:| ::...:|.:|..|..: |...:.:..||                   
plant   309 --------HNDRVRFSHYLNPKRIQDVICKGTDLFDMLPEEYTFREIIGKLGPIPRSYSAVHLPA 365

  Fly   450 ------QSEKYFAPEEALQHS 464
                  :|.||..|...::.|
plant   366 HLIEKAESYKYLLPGNCIRES 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31849NP_723787.1 None
AT5G14480NP_196952.1 Glyco_transf_17 38..385 CDD:398414 60/343 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D886866at2759
OrthoFinder 1 1.000 - - FOG0002697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104004
Panther 1 1.100 - - O PTHR12224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.