DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31849 and AT3G27540

DIOPT Version :9

Sequence 1:NP_723787.1 Gene:CG31849 / 318981 FlyBaseID:FBgn0051849 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_189391.1 Gene:AT3G27540 / 822376 AraportID:AT3G27540 Length:390 Species:Arabidopsis thaliana


Alignment Length:340 Identity:68/340 - (20%)
Similarity:116/340 - (34%) Gaps:96/340 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GWHGRDCGQPEIIWRALMTSNRASKRGGSTPLQLVEASSSSLHRLFYMLELGAWDHLSLELLELQ 229
            ||..||  .|..::.|::.||..                                    :||.::
plant   101 GWGIRD--SPRRVFDAVLFSNEK------------------------------------DLLTVR 127

  Fly   230 IRALIEVVDYFLI--------------YYVSNGSKERSLESMLGSQTSYTLL--RCSSESNCTSS 278
            ...|...|..|:|              .:.||..:.:.:|..|    :|..:  |.....|....
plant   128 WNELYPYVTQFVILESNSTFTGLPKPLVFKSNKDQFKFVEPRL----TYGTIGGRFRKGENPFVE 188

  Fly   279 MAYSHFR-RQLWQQCGVQMQAQDLLLHGDSGTVYAPAALKFLKYYAKDVLP-LKFRLKYNVYGFY 341
            .||.... .||.:..|:  |..|||:..|...:.:...:..|: :..|:.| |..:||..:|.|.
plant   189 EAYQRVALDQLLRIAGI--QEDDLLIMSDVDEIPSAHTINLLR-WCDDIPPVLHLQLKNYLYSFE 250

  Fly   342 WQHPKKTLLNGVISSLGHLHSAQLDAHRLHRLASSTLGDLNHYGGWNCELCLP-PEQIVLLLQ-- 403
            :....|:....:     |.:|.....:...|.::..|.|    .||:|..|.. ..:.:..::  
plant   251 YYVDSKSWRASI-----HRYSPGKTRYAHFRQSNVMLAD----SGWHCSFCFRYISEFIFKMKAY 306

  Fly   404 SSSPRKLPVKLPNDTRNAH-IDANYMQQLIANGVHI-DGTTQLHRLREQSEK-------YFA--- 456
            |.|.|         .|.:| ::...:|.:|..|..: |...:.:..:|...|       |.|   
plant   307 SHSDR---------VRFSHYLNPRRIQDVICKGTDLFDMLPEEYTFKEIIGKMGPVPRSYSAVHL 362

  Fly   457 PEEALQHSSQYGQLL 471
            |...|.::.||..||
plant   363 PSYLLYNAEQYKYLL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31849NP_723787.1 None
AT3G27540NP_189391.1 Glyco_transf_17 37..384 CDD:368082 68/340 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D886866at2759
OrthoFinder 1 1.000 - - FOG0002697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104004
Panther 1 1.100 - - O PTHR12224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.