DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31849 and AT3G26445

DIOPT Version :9

Sequence 1:NP_723787.1 Gene:CG31849 / 318981 FlyBaseID:FBgn0051849 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_683596.1 Gene:AT3G26445 / 822249 AraportID:AT3G26445 Length:118 Species:Arabidopsis thaliana


Alignment Length:70 Identity:14/70 - (20%)
Similarity:28/70 - (40%) Gaps:17/70 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LWQQC----GVQMQA-------------QDLLLHGDSGTVYAPAALKFLKYYAKDVLPLKFRLKY 335
            :::.|    ||.|::             .|||:..|...:.:...:..|::..:.......|||.
plant    19 IYRLCCVLRGVDMESYVFLLVIVPTFVLADLLIMSDVDEIPSRHTVNLLRWCNEITQIPHLRLKN 83

  Fly   336 NVYGF 340
            ::|.|
plant    84 SLYSF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31849NP_723787.1 None
AT3G26445NP_683596.1 Glyco_transf_17 <48..>114 CDD:282567 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D886866at2759
OrthoFinder 1 1.000 - - FOG0002697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.