powered by:
Protein Alignment CG31849 and AT3G26445
DIOPT Version :9
Sequence 1: | NP_723787.1 |
Gene: | CG31849 / 318981 |
FlyBaseID: | FBgn0051849 |
Length: | 487 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_683596.1 |
Gene: | AT3G26445 / 822249 |
AraportID: | AT3G26445 |
Length: | 118 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 28/70 - (40%) |
Gaps: | 17/70 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 288 LWQQC----GVQMQA-------------QDLLLHGDSGTVYAPAALKFLKYYAKDVLPLKFRLKY 335
:::.| ||.|:: .|||:..|...:.:...:..|::..:.......|||.
plant 19 IYRLCCVLRGVDMESYVFLLVIVPTFVLADLLIMSDVDEIPSRHTVNLLRWCNEITQIPHLRLKN 83
Fly 336 NVYGF 340
::|.|
plant 84 SLYSF 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31849 | NP_723787.1 |
None |
AT3G26445 | NP_683596.1 |
Glyco_transf_17 |
<48..>114 |
CDD:282567 |
10/41 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D886866at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002697 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.