DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS23 and Mrps23

DIOPT Version :9

Sequence 1:NP_723847.1 Gene:mRpS23 / 318977 FlyBaseID:FBgn0260407 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_077136.2 Gene:Mrps23 / 64656 MGIID:1928138 Length:177 Species:Mus musculus


Alignment Length:186 Identity:63/186 - (33%)
Similarity:99/186 - (53%) Gaps:26/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQSRLEKIGTIFTRVQGLLRGGAMKTEDKPIWYDVYAAFPPKLEPRFDRP-----APEIPVRQI 60
            ||.||||.:|::|:|.:.|:|.|.:|  :||:|||:|.||||..||.|.||     ..:..::.|
Mouse     1 MAGSRLETVGSVFSRTRDLMRAGVLK--EKPLWYDIYKAFPPLREPVFRRPRLRYGKAKADIQDI 63

  Fly    61 FYAEDVVRAKLHKE-NKPQETISLFDHRRSTQSQQFVQIYQDLKGQGALDEQRIY-ETALDLLAE 123
            ||.||.:|||.... ...|:...||:....:..|:||:.|.:|:..|..||:::: ||...||||
Mouse    64 FYQEDQIRAKFFATYGSGQKAFDLFNPNFKSTCQRFVEKYTELQNLGETDEEKLFVETGKALLAE 128

  Fly   124 ----------QRQQARLETTPEECLPEQDSESKSQLLSDFKEAVVSQQITSSPAPP 169
                      :....||:.:.|...|::|.:..       :...|.|:..::|:||
Mouse   129 GIILRRVREARTVSVRLQASSEGHEPQEDDDLA-------QRGQVKQEPETAPSPP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS23NP_723847.1 MRP-S23 2..124 CDD:287459 52/138 (38%)
Mrps23NP_077136.2 MRP-S23 2..128 CDD:287459 50/127 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..177 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845945
Domainoid 1 1.000 94 1.000 Domainoid score I7495
eggNOG 1 0.900 - - E1_2C9V7
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41101
Inparanoid 1 1.050 101 1.000 Inparanoid score I4970
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007507
OrthoInspector 1 1.000 - - oto92435
orthoMCL 1 0.900 - - OOG6_108527
Panther 1 1.100 - - LDO PTHR15925
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.750

Return to query results.
Submit another query.