DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS23 and mrps23

DIOPT Version :9

Sequence 1:NP_723847.1 Gene:mRpS23 / 318977 FlyBaseID:FBgn0260407 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_005157745.1 Gene:mrps23 / 445221 ZFINID:ZDB-GENE-040801-134 Length:188 Species:Danio rerio


Alignment Length:192 Identity:74/192 - (38%)
Similarity:102/192 - (53%) Gaps:14/192 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQSRLEKIGTIFTRVQGLLRGGAMKTEDKPIWYDVYAAFPPKLEPRFDRP-APEI----PVRQI 60
            ||.|||||.||:||||:.|||.|.:|.|:||||||||||||||.||.:.:| .|.:    ||.|:
Zfish     1 MAGSRLEKFGTVFTRVRDLLRAGVLKPEEKPIWYDVYAAFPPKKEPLYQKPRRPRVPAADPVPQL 65

  Fly    61 FYAEDVVRAKLHK--ENKPQETISLFDHRRSTQSQQFVQIYQDLKGQGALDEQRIYETALDLLAE 123
            ||.||.:|||..:  .|.|:....|..:..|: .|:||..|.:|:.:|.:..:.::|.....|..
Zfish    66 FYKEDEIRAKFFEVYGNGPKAFEPLMPNFISS-CQKFVMKYSELESRGDIKPELLFEETAKALLS 129

  Fly   124 QRQQARLETTPEECLPEQDSESKSQLLSDFKEAVVSQQITSSPAPPAPKGKKEANVGINIDS 185
            :....|....|.:..||......|..|:|.   :..||  .......|:.:.||.. :|.||
Zfish   130 EGIYLRKRGGPVQVAPESRDPLLSMKLTDM---LAEQQ--KDKETNIPEKQPEAET-LNPDS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS23NP_723847.1 MRP-S23 2..124 CDD:287459 58/128 (45%)
mrps23XP_005157745.1 MRP-S23 2..130 CDD:287459 58/128 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590653
Domainoid 1 1.000 105 1.000 Domainoid score I6625
eggNOG 1 0.900 - - E1_2C9V7
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41101
Inparanoid 1 1.050 110 1.000 Inparanoid score I4864
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115569at2759
OrthoFinder 1 1.000 - - FOG0007507
OrthoInspector 1 1.000 - - oto40144
orthoMCL 1 0.900 - - OOG6_108527
Panther 1 1.100 - - LDO PTHR15925
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8109
SonicParanoid 1 1.000 - - X5638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.