DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS23 and Mrps23

DIOPT Version :9

Sequence 1:NP_723847.1 Gene:mRpS23 / 318977 FlyBaseID:FBgn0260407 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001101759.1 Gene:Mrps23 / 360594 RGDID:1306963 Length:177 Species:Rattus norvegicus


Alignment Length:192 Identity:64/192 - (33%)
Similarity:100/192 - (52%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQSRLEKIGTIFTRVQGLLRGGAMKTEDKPIWYDVYAAFPPKLEPRFDRP-----APEIPVRQI 60
            ||.||||.:|::|:|.:.|:|.|.:|  :||:|||:|.||||..||.|.||     ..:..::.|
  Rat     1 MAGSRLETVGSVFSRTRDLMRAGVLK--EKPLWYDIYKAFPPLKEPVFRRPRLRYGKAKADIQDI 63

  Fly    61 FYAEDVVRAKL-------HKENKPQETISLFDHRRSTQSQQFVQIYQDLKGQGALDEQRIY-ETA 117
            ||.||.:|||.       ||      .|.||:....:..|:||:.|.:|:..|..||:::: ||.
  Rat    64 FYREDQIRAKFFSTYGSGHK------AIDLFNPNFKSTCQRFVEKYTELQSLGETDEEKLFVETG 122

  Fly   118 LDLLAE----------QRQQARLETTPEECLPEQDSESKSQLLSDFKEAVVSQQITSSPAPP 169
            ..||||          :....||:::.|...|.::...|.::       .|.|:..::.:||
  Rat   123 KALLAEGVILRRVREAKTVNVRLQSSSEGNDPLEEDGQKQRV-------QVKQEPETASSPP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS23NP_723847.1 MRP-S23 2..124 CDD:287459 54/144 (38%)
Mrps23NP_001101759.1 MRP-S23 2..128 CDD:287459 52/133 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349376
Domainoid 1 1.000 94 1.000 Domainoid score I7329
eggNOG 1 0.900 - - E1_2C9V7
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41101
Inparanoid 1 1.050 96 1.000 Inparanoid score I4954
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115569at2759
OrthoFinder 1 1.000 - - FOG0007507
OrthoInspector 1 1.000 - - oto95999
orthoMCL 1 0.900 - - OOG6_108527
Panther 1 1.100 - - LDO PTHR15925
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.