DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS23 and rsm25

DIOPT Version :9

Sequence 1:NP_723847.1 Gene:mRpS23 / 318977 FlyBaseID:FBgn0260407 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_596785.1 Gene:rsm25 / 2539878 PomBaseID:SPBC16A3.04 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:40/175 - (22%)
Similarity:67/175 - (38%) Gaps:44/175 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLLRGGAMKTEDKP-----IWYDVYAAFPP------KLEPRFD----------------RPA--- 52
            ||||..|.:.: ||     :||:..|..||      ::.|.:|                :|.   
pombe     8 GLLRSFAAEMK-KPWTAESLWYETVAKHPPTFQYARRIVPLYDPNKVKSRGKRLRKSMYQPQEIQ 71

  Fly    53 -PEIPVRQIFYAE---DVVRAKLHKENKPQE----TISLFDH-RRSTQSQQFVQIYQDLKGQGAL 108
             ||..:|:.||.:   ::.|.::..||...:    ..|..|. |::...:..||....|.....:
pombe    72 WPEDKLRKRFYRDHPWELARPQIIAENDGNDQQYCDWSHMDQPRKALSGESVVQRTLWLIENSNM 136

  Fly   109 DEQRIYETA----LDLLAEQRQQARLETTPEECLPEQDSESKSQL 149
            ..:..|:.|    ..|.|||..|.|:.....:.|....::|..:|
pombe   137 PVENAYDQARKEFYHLRAEQEIQQRVAHDQAQALGAVFTKSDLEL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS23NP_723847.1 MRP-S23 2..124 CDD:287459 33/148 (22%)
rsm25NP_596785.1 MRP-S25 6..202 CDD:290459 40/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15925
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.