DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS23 and mrps-23

DIOPT Version :9

Sequence 1:NP_723847.1 Gene:mRpS23 / 318977 FlyBaseID:FBgn0260407 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_499099.1 Gene:mrps-23 / 191523 WormBaseID:WBGene00014224 Length:133 Species:Caenorhabditis elegans


Alignment Length:131 Identity:49/131 - (37%)
Similarity:71/131 - (54%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SRLEKIGTIFTRVQGLLRGGAMKTEDKPIWYDVYAAFPPKLEP-------RFDRPAPEIPVRQIF 61
            :|.|:.|.||:||.||:|.|.:...|:|:|||||.:.||...|       ::|.     |:|.||
 Worm     6 TRAERSGNIFSRVTGLIRAGQLNWADRPLWYDVYVSSPPLTPPDWNVKLAKYDE-----PIRSIF 65

  Fly    62 YAEDVVRAKLHKENKPQETISLFDHRRSTQSQQFVQIYQDLKGQGALDEQRIYETALDLLAEQRQ 126
            |.|||:|||.:|..:....|.: |..|::.||||:..|:.:|.:.|       |...|.|.|..|
 Worm    66 YEEDVLRAKFYKTYRSTAGIQV-DSSRTSVSQQFINEYKLVKSENA-------EATDDQLFEMTQ 122

  Fly   127 Q 127
            :
 Worm   123 K 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS23NP_723847.1 MRP-S23 2..124 CDD:287459 47/126 (37%)
mrps-23NP_499099.1 MRP-S23 6..128 CDD:287459 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164074
Domainoid 1 1.000 84 1.000 Domainoid score I5299
eggNOG 1 0.900 - - E1_2C9V7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3752
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007507
OrthoInspector 1 1.000 - - oto19952
orthoMCL 1 0.900 - - OOG6_108527
Panther 1 1.100 - - LDO PTHR15925
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8109
SonicParanoid 1 1.000 - - X5638
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.