DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS23 and mrps23

DIOPT Version :9

Sequence 1:NP_723847.1 Gene:mRpS23 / 318977 FlyBaseID:FBgn0260407 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_002932318.1 Gene:mrps23 / 100380047 XenbaseID:XB-GENE-981405 Length:187 Species:Xenopus tropicalis


Alignment Length:184 Identity:70/184 - (38%)
Similarity:100/184 - (54%) Gaps:41/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQSRLEKIGTIFTRVQGLLRGGAMKTEDKPIWYDVYAAFPPKLEPRFDRP------APEIPVRQ 59
            ||.|||||:||:|:||:.|||.|.:|..:||:|||||||||||.||.:::|      ..:| |..
 Frog     1 MAGSRLEKLGTVFSRVRDLLRAGIIKQNEKPVWYDVYAAFPPKREPLYEKPLRRKQITSDI-VPS 64

  Fly    60 IFYAEDVVRAKLHKE--NKPQETISLFDHRRS---TQSQQFVQIYQDLKGQGALDEQRIY-ETAL 118
            |.|.||::|||.::.  |.|:    .|:..|:   :..|:||:.|.:|:..|..||.::: ||..
 Frog    65 ILYKEDIIRAKFYETYGNGPR----AFELSRTNFKSSCQRFVEKYAELQKMGEEDESKLFEETGK 125

  Fly   119 DLLAE--------------------QRQQARLETTPEECLPE----QDSESKSQ 148
            .||||                    :||...||...::.|.|    |..|.|:|
 Frog   126 ALLAEGIILRRKGTYVAQPQQPQESERQDPLLEMNLKKMLEEIQQQQQQEEKTQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS23NP_723847.1 MRP-S23 2..124 CDD:287459 59/153 (39%)
mrps23XP_002932318.1 MRP-S23 2..130 CDD:371083 57/132 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6932
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41101
Inparanoid 1 1.050 105 1.000 Inparanoid score I4815
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115569at2759
OrthoFinder 1 1.000 - - FOG0007507
OrthoInspector 1 1.000 - - oto102739
Panther 1 1.100 - - LDO PTHR15925
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8109
SonicParanoid 1 1.000 - - X5638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.