DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31835 and Stmn2

DIOPT Version :9

Sequence 1:NP_723881.1 Gene:CG31835 / 318972 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_445892.1 Gene:Stmn2 / 84510 RGDID:68947 Length:179 Species:Rattus norvegicus


Alignment Length:151 Identity:31/151 - (20%)
Similarity:68/151 - (45%) Gaps:24/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 IFTRNHMRHHRQSQLQTTPNSRIFDISVWLSTGRVSSDPQLLSNNDPPEEAANSESLALGLSSGG 216
            |:|.:.|   ...|:....:.:.|:: :......:|..|:.|::  |.::..:.|.:...|.:..
  Rat    34 IYTYDDM---EVKQINKRASGQAFEL-ILKPPSPISEAPRTLAS--PKKKDLSLEEIQKKLEAAE 92

  Fly   217 PFEHDDDRYVLLQWIAQQKVQCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGE 281
            ......:..||.| :|:::     ..|.:.|::.| .|:...|.:..|:|.|.  ..:|:| |.|
  Rat    93 GRRKSQEAQVLKQ-LAEKR-----EHEREVLQKAL-EENNNFSKMAEEKLILK--MEQIKE-NRE 147

  Fly   282 SDL--------DQENHSSLVK 294
            ::|        ::|.|::.|:
  Rat   148 ANLAAIIERLQEKERHAAEVR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078
zf-Di19 76..130 CDD:283297
Stmn2NP_445892.1 Membrane attachment. /evidence=ECO:0000255 1..26
Stathmin 39..174 CDD:395674 29/146 (20%)
Regulatory/phosphorylation domain. /evidence=ECO:0000255 39..96 9/62 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.