DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31835 and KCMF1

DIOPT Version :9

Sequence 1:NP_723881.1 Gene:CG31835 / 318972 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006712115.1 Gene:KCMF1 / 56888 HGNCID:20589 Length:389 Species:Homo sapiens


Alignment Length:356 Identity:88/356 - (24%)
Similarity:130/356 - (36%) Gaps:108/356 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPLLYGEIPE 70
            :.|:.|....|:|.|::||.|.:|:||..||:....|..|..:||||......|. .|.||....
Human    15 VSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDF-DLYYGGEAF 78

  Fly    71 LVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAELVAIRHLSKHLLHNH 135
            .|.....||||:||.:..|.....|||..:|..::..|:||:||.|...:            .||
Human    79 SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD------------PNH 131

  Fly   136 I--DHANYLEPDTPPLRRIFTRNHMRH-----H----------RQSQLQTTPNSRIFDISVWLST 183
            :  |.|.:|..:....|.:...:.:||     |          |:|.:..|.:|     :..||:
Human   132 VTDDFAAHLTLEHRAPRDLDESSGVRHVRRMFHPGRGLGGPRARRSNMHFTSSS-----TGGLSS 191

  Fly   184 GRVSSDPQLLSNNDPPEEAANSESLALGL--SSGGPFEHDDDRYVLLQWI--------------- 231
            .:.|..|   ||.:..:..|...|...|:  |:||...........||.:               
Human   192 SQSSYSP---SNREAMDPIAELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAAR 253

  Fly   232 ------------------------------------AQQKVQ-------------CHDTD----E 243
                                                :||.:|             ..:|:    |
Human   254 QQLETARNATRRTNTSSVTTTITQSTATTNIANTESSQQTLQNSQFLLTRLNDPKMSETERQSME 318

  Fly   244 SQRLRRTLFVEHLLISMLCCEELQLPDGDRR 274
            |:|..|:|||:.||:|.|..||....|.|.|
Human   319 SERADRSLFVQELLLSTLVREESSSSDEDDR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 19/47 (40%)
zf-Di19 76..130 CDD:283297 17/53 (32%)
KCMF1XP_006712115.1 ZZ_PCMF_like 15..63 CDD:239078 19/47 (40%)
zf-Di19 84..145 CDD:283297 22/72 (31%)
Di19_C <288..336 CDD:291251 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6024
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4843
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.