DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31835 and STMN3

DIOPT Version :9

Sequence 1:NP_723881.1 Gene:CG31835 / 318972 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_056978.2 Gene:STMN3 / 50861 HGNCID:15926 Length:180 Species:Homo sapiens


Alignment Length:72 Identity:17/72 - (23%)
Similarity:34/72 - (47%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 QLQTTPNSRIFDISVWLSTGRVSSDPQLLSNNDPPEEAANS-ESLALGLSSGGPFEHDDDRYVLL 228
            ||....:.:.|:: :..|...:|.:..:||:  ||::...| |.|...|.:........:..||.
Human    44 QLDKRASGQSFEV-ILKSPSDLSPESPMLSS--PPKKKDTSLEELQKRLEAAEERRKTQEAQVLK 105

  Fly   229 QWIAQQK 235
            | :|:::
Human   106 Q-LAERR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078
zf-Di19 76..130 CDD:283297
STMN3NP_056978.2 Stathmin 39..175 CDD:395674 17/72 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..82 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.