DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31835 and stai

DIOPT Version :9

Sequence 1:NP_723881.1 Gene:CG31835 / 318972 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster


Alignment Length:393 Identity:79/393 - (20%)
Similarity:138/393 - (35%) Gaps:121/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CNGC-QMTIFQGSRFRCLRC---VNYNLCDICYD--HQIETEEHRANHPMQLFPDSDDLVPLLYG 66
            |.|| |:......|:.|..|   |.|  |..|:|  ....||.|:.:..:::......|.....|
  Fly    12 CKGCGQIRADFDRRYGCSECGSEVMY--CGQCFDEGRNQHTETHKDDRRIKIIYHRSFLDKFFSG 74

  Fly    67 EIPELVH--LSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAELVAIRHLSK 129
            |  :|::  .|..:.|..|      .|||                       ||.||..  |||:
  Fly    75 E--KLLNGDASKSYNCVFC------KKRF-----------------------SAEELQL--HLSE 106

  Fly   130 HLLHNHIDHANYLEPDTPPLR------RIFTRNHMRHHRQSQLQ------------------TTP 170
              :|::...|:.|......:|      ||.|....:...:..|.                  .||
  Fly   107 --MHSNPADASALTVMLERMRQEDLENRIATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTP 169

  Fly   171 --NSRIFDISVWLSTG---RVSSDPQLLSNNDPP----EEAA-------------NSESLALGLS 213
              |..:.:|...|...   |:|.:.:.:::....    |||.             ..|.|...:.
  Fly   170 GKNVSVEEIEQKLKAAEERRISLEAKKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKME 234

  Fly   214 SGGPFEHDDDRYVLLQWIAQQKVQCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREG 278
            .     |.:.|..::..: ::|::.|..| .::.|.||..:.........|:|::.   :.:|:.
  Fly   235 L-----HVEKREAIISDM-KEKLKIHAQD-IEKTRETLEQQKANEQKAIEEKLKIA---QSLRDE 289

  Fly   279 NGESDLDQENHSSLVKVMSVMSLPWTGVWQTNQLDGSEGEGEIRAAKKDGVDLDKVQIEEHKRVA 343
            |.:..||:....:.:|:..:.|       |.:||:..:.|             :|.:|.|:|..|
  Fly   290 NIKKMLDRLKEHNTIKIAEIKS-------QNDQLECQKIE-------------EKARIYENKLFA 334

  Fly   344 AEE 346
            ||:
  Fly   335 AEQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 15/51 (29%)
zf-Di19 76..130 CDD:283297 12/53 (23%)
staiNP_001245912.1 Stathmin 138..267 CDD:279209 21/135 (16%)
beta_CA <242..313 CDD:294276 14/82 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.