DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31835 and dah

DIOPT Version :9

Sequence 1:NP_723881.1 Gene:CG31835 / 318972 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_511162.1 Gene:dah / 32459 FlyBaseID:FBgn0015926 Length:649 Species:Drosophila melanogaster


Alignment Length:350 Identity:78/350 - (22%)
Similarity:120/350 - (34%) Gaps:85/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPM-QLFPDSDDLVPLLYG 66
            |.|.|. ||:.....|.||||..|.:.:||..|:........|...|.| ::|  .:|..||.:.
  Fly   279 HSNSCA-GCRKEHIVGIRFRCQVCRDISLCLPCFAVGFAGGRHEPGHRMCEVF--VEDQPPLRWT 340

  Fly    67 EIPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAELVAIRHLSKHL 131
            .     ||:..     ||.|.:..|...|.   :....|.....| ..|.|||..:.....|...
  Fly   341 R-----HLARL-----CGWLVMPRKTQEEE---RRGFCNAQESGP-ALGQSAATPIPAETRSVRS 391

  Fly   132 LHNHIDHANYLEPD--------------TPPLRRIFTRNHMRHHR-QSQLQTTPNSRIFDISVWL 181
            .....|....|:..              :..|:.|..|..:::.: ::||||...:...:||.:|
  Fly   392 QCQEKDRTVVLQQQQQELCSLTGLASEASSRLQSIIDRLLLQNAKLETQLQTVATASSSEISQFL 456

  Fly   182 STG-----RVSSDPQLLSN-----NDPPEEAANSESLALGLSSGGPFEHDDDRYVLLQWIAQQKV 236
            |..     ::..|.:.||:     :.||..||.....|..|.|.             .:::....
  Fly   457 SAHQCFLLQIIEDMRQLSHASAVTSPPPAPAAQVAPSAAPLVSS-------------TFLSSSTP 508

  Fly   237 QCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGESDLDQENHSSLVKVMSVMSL 301
            |          |:.||            ::..|.|.......|| :||   |.|.|....|..||
  Fly   509 Q----------RQMLF------------DMYAPVGANLTHSING-ADL---NRSYLEANKSDYSL 547

  Fly   302 PWTGVW---QTNQLDGSEGEGEIRA 323
            ....:|   :.:.:...:|.|.:.|
  Fly   548 NDISLWFDQRRSSVQPGQGPGSLPA 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 15/48 (31%)
zf-Di19 76..130 CDD:283297 12/53 (23%)
dahNP_511162.1 EF-hand_2 44..168 CDD:286194
ZZ_dah 281..329 CDD:239085 16/48 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.