DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fgg

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001304034.1 Gene:Fgg / 99571 MGIID:95526 Length:443 Species:Mus musculus


Alignment Length:183 Identity:66/183 - (36%)
Similarity:98/183 - (53%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFG--DPNG--EFFIGLQKLYLMTREQ--PHELFIQLKHGPG 114
            |.|:|:|:|||::|.::|..||:|||  .|.|  ||::|.:|::|::.:.  |:.|.||||...|
Mouse   216 WTVLQKRIDGSLDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNG 280

  Fly   115 ATVYAHFDDFQVDSETELYKLERVGKYSGTAGDS--------------LRYHINKRFSTFDRDND 165
            .|..|.:..|:|..|::.|:|.......|.|||:              ...|...:|||:|.|||
Mouse   281 RTSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDND 345

  Fly   166 ESSKNCAAEHGGGWWFHSCLSSSLNGLYFREG-------ETGMLNGIHWGRWK 211
            :...|||.:.|.|||.:.|.:..|||:|.:.|       ..|..:||.|..||
Mouse   346 KFEGNCAEQDGSGWWMNKCHAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 66/183 (36%)
FggNP_001304034.1 Fib_alpha 30..171 CDD:285864
FReD 174..413 CDD:294064 66/183 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.