DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fibcd1

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_849218.2 Gene:Fibcd1 / 98970 MGIID:2138953 Length:459 Species:Mus musculus


Alignment Length:227 Identity:88/227 - (38%)
Similarity:123/227 - (54%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PHTCPSGS--------------PNGIHQLMLPEEEP--FQV-TQCKTTARDWIVIQRRLDGSVNF 69
            |..|.:||              .:|::.: .|...|  ||| ...:|....|.|.|||.||||||
Mouse   230 PRGCANGSRPRDCLDVLLSGQQDDGVYSI-FPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNF 293

  Fly    70 NQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDD-----FQVDSE 129
            .:.|.:|::|||...||.::||::::.:|.:..:||.:.|:.....|.|||:..     |.||.|
Mouse   294 FRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPE 358

  Fly   130 TELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYF 194
            .:.|.| .|..|||||||||..|...||:|.|||:|.|..||||.:.|.||:.:|.:|:|||.|.
Mouse   359 EDGYPL-TVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYL 422

  Fly   195 REGETGMLNGIHWGRWK-FQ-SLTFVQIMIRP 224
            |.......:|:.|..|. :| ||.|.::.|||
Mouse   423 RGAHASYADGVEWSSWTGWQYSLKFSEMKIRP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 86/221 (39%)
Fibcd1NP_849218.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
FReD 239..455 CDD:238040 84/218 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.