DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fibcd1

DIOPT Version :10

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_849218.2 Gene:Fibcd1 / 98970 MGIID:2138953 Length:459 Species:Mus musculus


Alignment Length:227 Identity:88/227 - (38%)
Similarity:123/227 - (54%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PHTCPSGS--------------PNGIHQLMLPEEEP--FQV-TQCKTTARDWIVIQRRLDGSVNF 69
            |..|.:||              .:|::.: .|...|  ||| ...:|....|.|.|||.||||||
Mouse   230 PRGCANGSRPRDCLDVLLSGQQDDGVYSI-FPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNF 293

  Fly    70 NQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDD-----FQVDSE 129
            .:.|.:|::|||...||.::||::::.:|.:..:||.:.|:.....|.|||:..     |.||.|
Mouse   294 FRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPE 358

  Fly   130 TELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYF 194
            .:.|.| .|..|||||||||..|...||:|.|||:|.|..||||.:.|.||:.:|.:|:|||.|.
Mouse   359 EDGYPL-TVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYL 422

  Fly   195 REGETGMLNGIHWGRWK-FQ-SLTFVQIMIRP 224
            |.......:|:.|..|. :| ||.|.::.|||
Mouse   423 RGAHASYADGVEWSSWTGWQYSLKFSEMKIRP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 86/221 (39%)
Fibcd1NP_849218.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
FReD 239..455 CDD:238040 84/218 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.