DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and ANGPTL1

DIOPT Version :10

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004664.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:234 Identity:84/234 - (35%)
Similarity:133/234 - (56%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TCPSGSPNGIHQLMLPEEEPFQVTQ---------------------------CKTT--ARDWIVI 59
            |.|:.||..|..:....|.||:..|                           |:.:  ...|.||
Human   257 TSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVI 321

  Fly    60 QRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDF 124
            |:|.||||||.::|.:||.|||:.:||:::||:.:|:::.:..::|.|:|:......|||.:..|
Human   322 QKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSF 386

  Fly   125 QVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSL 189
            :::.|:|.|:| |:|.|.|.||||:.:|..|:|:|.|||.|..:.|||..|.||||:::|..|:|
Human   387 RLEPESEFYRL-RLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNL 450

  Fly   190 NGLYFREG--ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            ||:::|.|  .:...:||.|..::  ..||..||:||:|
Human   451 NGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 82/230 (36%)
ANGPTL1NP_004664.1 PB1 74..138 CDD:413452
FReD 275..490 CDD:238040 78/216 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.