DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and ANGPTL1

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:234 Identity:84/234 - (35%)
Similarity:133/234 - (56%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TCPSGSPNGIHQLMLPEEEPFQVTQ---------------------------CKTT--ARDWIVI 59
            |.|:.||..|..:....|.||:..|                           |:.:  ...|.||
Human   257 TSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVI 321

  Fly    60 QRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDF 124
            |:|.||||||.::|.:||.|||:.:||:::||:.:|:::.:..::|.|:|:......|||.:..|
Human   322 QKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSF 386

  Fly   125 QVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSL 189
            :::.|:|.|:| |:|.|.|.||||:.:|..|:|:|.|||.|..:.|||..|.||||:::|..|:|
Human   387 RLEPESEFYRL-RLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNL 450

  Fly   190 NGLYFREG--ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            ||:::|.|  .:...:||.|..::  ..||..||:||:|
Human   451 NGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 82/230 (36%)
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100
FReD 275..490 CDD:238040 78/216 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.