DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fgl2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:246 Identity:93/246 - (37%)
Similarity:128/246 - (52%) Gaps:45/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CPS---GSPNGIHQLMLPE----------------------EEPFQV-TQCKTTARDWIVIQRRL 63
            |||   ..||.:..|:..:                      ...|:| ...:||...|.|:|.||
  Rat   184 CPSQEHNQPNPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGGGWTVLQARL 248

  Fly    64 DGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDS 128
            |||.||.:.|..||.|||:...||::|..|::|:|:.:...|.|.|:...|.|:||.:|.|.|.:
  Rat   249 DGSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVAN 313

  Fly   129 ETELYKLERVGKYSGTAGDSLRY--HIN---KRFSTFDRDNDE-SSKNCAAEHGGGWWFHSCLSS 187
            |...|:| .:|.|:|||||:||:  |.|   :.|:|.|||||. .|.||...:..||||.:|||:
  Rat   314 EFLKYRL-HLGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLSA 377

  Fly   188 SLNGLYFREGETGMLNGIHWGRW-----------KFQSLTFVQIMIRPKYF 227
            :|||.|:.:...|:.|||.||.|           || |....::|||||.|
  Rat   378 NLNGKYYHQRYKGVRNGIFWGTWPGVSQAHPGGYKF-SFKKAKMMIRPKSF 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 87/236 (37%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399
Fibrinogen_C 199..425 CDD:278572 84/227 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4104
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.