DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Mfap4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001334474.1 Gene:Mfap4 / 76293 MGIID:1342276 Length:281 Species:Mus musculus


Alignment Length:204 Identity:75/204 - (36%)
Similarity:104/204 - (50%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFF------------------------IGL 91
            |....|.|.|:|.:|||:|.:.|..||.|||..:||::                        :||
Mouse    76 TEGGKWTVFQKRFNGSVSFFRGWSDYKLGFGRADGEYWLGKVGPWGGGCPSAKSLLTGCHPSLGL 140

  Fly    92 QKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQ-----VDSETELYKLERVGKYSGTAGDSLRY 151
            |.|:|:|.:|.:||.:.|:.....|.||.:.||.     :.:|.:.|.|...|...|.|||||.|
Mouse   141 QNLHLLTLKQKYELRVDLEDFENNTAYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLSY 205

  Fly   152 HINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWK--FQS 214
            |..::|||||||.|...:||||...|.:||.||..::|||.|.........|||:|.:||  :.|
Mouse   206 HSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYS 270

  Fly   215 LTFVQIMIR 223
            |...::.||
Mouse   271 LKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/204 (37%)
Mfap4NP_001334474.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.