DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and LOC594984

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001025596.1 Gene:LOC594984 / 594984 -ID:- Length:318 Species:Xenopus tropicalis


Alignment Length:201 Identity:74/201 - (36%)
Similarity:107/201 - (53%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SPNGIHQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQ 92
            |.:|.:.:..|...|..| ...:|....|||.|||.||||:|.|.|.|||.|||..:.||::|.:
 Frog   118 SISGWYTIYRPNGLPLPVFCDMETDGGGWIVFQRRKDGSVDFFQEWDSYKRGFGRQDSEFWLGNE 182

  Fly    93 KLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRF 157
            .|:|:|.....:|.:.|........:|.:.:|::..|:..|.|...|...|.|||||..|.|:.|
 Frog   183 NLHLLTATGNFQLRVDLMDFDSNRTFASYSNFRIGGESRNYTLSLGGFTGGDAGDSLSGHKNREF 247

  Fly   158 STFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHW---GRWKFQSLTFVQ 219
            |:.|||||.|..:||..:.|.||:..|.:|:|||||.........||::|   |.:.: |....:
 Frog   248 SSKDRDNDSSPTSCAERYKGAWWYSGCHTSNLNGLYLGGKHGSFANGVNWKSGGGYNY-SYKVSE 311

  Fly   220 IMIRPK 225
            :..||:
 Frog   312 MKFRPQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/199 (37%)
LOC594984NP_001025596.1 Collagen 42..99 CDD:189968
FReD 107..316 CDD:238040 72/198 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.