DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Angptl4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_065606.2 Gene:Angptl4 / 57875 MGIID:1888999 Length:410 Species:Mus musculus


Alignment Length:223 Identity:79/223 - (35%)
Similarity:115/223 - (51%) Gaps:26/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKD 78
            ||:.|:..         :|:.|:......||.|....|:...|.||||||:|||:|||||.:|||
Mouse   195 LFQEGERH---------SGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKD 250

  Fly    79 GFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSG 143
            |||||.|||::||:|::.:|..:..:|.:||:...|......| ...:..|...|.|:..   ..
Mouse   251 GFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQF-PIHLGGEDTAYSLQLT---EP 311

  Fly   144 TAGDSLRYHINKR-----FSTFDRDND-ESSKNCAAEHGGGWWFHSCLSSSLNGLYF----REGE 198
            ||.:....:::..     |||:|:|:| ....|||....|||||.:|..|:|||.||    |:.:
Mouse   312 TANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQ 376

  Fly   199 TGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            . ...||.|..||  :..|....::|:|
Mouse   377 E-RKKGIFWKTWKGRYYPLQATTLLIQP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/209 (36%)
Angptl4NP_065606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..101
Fib_alpha <104..133 CDD:285864
FReD 187..404 CDD:238040 79/223 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.