DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and angptl2a

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001025401.1 Gene:angptl2a / 569092 ZFINID:ZDB-GENE-080721-15 Length:525 Species:Danio rerio


Alignment Length:173 Identity:72/173 - (41%)
Similarity:117/173 - (67%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120
            |.|||||:||||||.::|.:||.|||:.:||:::||:.:|.:|.:..::|.:.|:...|...:|.
Zfish   348 WTVIQRRMDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTLEDWSGRKTFAE 412

  Fly   121 FDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCL 185
            :..|:::.|.:.||: |||:|.|.||||:.:|..|:|:|.|||:|..:.|||....||||:::|.
Zfish   413 YASFRLEPEADFYKM-RVGRYHGNAGDSMTWHNGKQFTTLDRDHDAYTGNCAHYQKGGWWYNACA 476

  Fly   186 SSSLNGLYFREG--ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            .|:|||:::|.|  .:...:|::|..::  ..||..|.:||||
Zfish   477 HSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVTMMIRP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 72/173 (42%)
angptl2aNP_001025401.1 DUF1875 <50..>147 CDD:286100
Fib_alpha 119..215 CDD:285864
FReD 305..519 CDD:238040 70/171 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.