DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fgl1b

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017213536.1 Gene:fgl1b / 563523 ZFINID:ZDB-GENE-130530-668 Length:348 Species:Danio rerio


Alignment Length:205 Identity:73/205 - (35%)
Similarity:111/205 - (54%) Gaps:20/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD---PNGEFFIGLQKLYLMTRE 100
            |..|||.|.........|.|||:|::|.|:|::.|..||:|||:   ...||::|...::::..:
Zfish   130 PLLEPFLVYCDMDDGGAWTVIQKRINGKVDFDRKWEDYKNGFGNFQSSKDEFWLGNDHIHVLLSD 194

  Fly   101 QPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL-----------RYHIN 154
            ....:.|.|....|...||.:|:|:|..|.:.|:| ..|.|||.|||:|           ..|..
Zfish   195 GDSVMKIDLTDWKGGKSYAMYDNFKVSDEKDKYRL-YYGMYSGQAGDALSGGANMVEQWSASHNG 258

  Fly   155 KRFSTFDRDNDESSK-NCAAEHGGGWWFHSCLSSSLNGLYFREGE--TGMLNGIHWGRWK--FQS 214
            .:|||.|:|:|...: :||||:.||||::.|.:::|||.::|.||  ....|||.|..||  :.|
Zfish   259 MQFSTRDQDHDRYLQGSCAAENKGGWWYNRCHAANLNGRFYRGGEYKAKYDNGIVWSTWKGLWYS 323

  Fly   215 LTFVQIMIRP 224
            |....:.:||
Zfish   324 LRHTVMKVRP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/205 (36%)
fgl1bXP_017213536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.